| Name | C20ORF195 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3953 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C20ORF195 antibody was raised using the N terminal Of C20Orf195 corresponding to a region with amino acids RMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDPRPFLADWALV |
| Purity/Format | Affinity purified |
| Blocking Peptide | C20ORF195 Blocking Peptide |
| Description | Rabbit polyclonal C20ORF195 antibody raised against the N terminal Of C20Orf195 |
| Gene | C20orf195 |
| Supplier Page | Shop |