CENPA antibody

Name CENPA antibody
Supplier Fitzgerald
Catalog 70R-1035
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen CENPA antibody was raised using the N terminal of CENPA corresponding to a region with amino acids MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE
Purity/Format Total IgG Protein A purified
Blocking Peptide CENPA Blocking Peptide
Description Rabbit polyclonal CENPA antibody raised against the N terminal of CENPA
Gene CENPA
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.