| Name | CENPA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1035 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | CENPA antibody was raised using the N terminal of CENPA corresponding to a region with amino acids MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CENPA Blocking Peptide |
| Description | Rabbit polyclonal CENPA antibody raised against the N terminal of CENPA |
| Gene | CENPA |
| Supplier Page | Shop |