HSPB6 antibody

Name HSPB6 antibody
Supplier Fitzgerald
Catalog 70R-1292
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen HSPB6 antibody was raised using the middle region of HSPB6 corresponding to a region with amino acids ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS
Purity/Format Total IgG Protein A purified
Blocking Peptide HSPB6 Blocking Peptide
Description Rabbit polyclonal HSPB6 antibody raised against the middle region of HSPB6
Gene HSPB6
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.