PITPNB antibody

Name PITPNB antibody
Supplier Fitzgerald
Catalog 70R-3120
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAY
Purity/Format Affinity purified
Blocking Peptide PITPNB Blocking Peptide
Description Rabbit polyclonal PITPNB antibody raised against the middle region of PITPNB
Gene PITPNB
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.