Name | Semenogelin I antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5491 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Semenogelin I antibody was raised using the middle region of SEMG1 corresponding to a region with amino acids KDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY |
Purity/Format | Affinity purified |
Blocking Peptide | Semenogelin I Blocking Peptide |
Description | Rabbit polyclonal Semenogelin I antibody raised against the middle region of SEMG1 |
Gene | SEMA5B |
Supplier Page | Shop |