| Name | Semenogelin I antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5491 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Semenogelin I antibody was raised using the middle region of SEMG1 corresponding to a region with amino acids KDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY |
| Purity/Format | Affinity purified |
| Blocking Peptide | Semenogelin I Blocking Peptide |
| Description | Rabbit polyclonal Semenogelin I antibody raised against the middle region of SEMG1 |
| Gene | SEMA5B |
| Supplier Page | Shop |