| Name | WDR13 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1131 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | WDR13 antibody was raised using the N terminal of WDR13 corresponding to a region with amino acids GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | WDR13 Blocking Peptide |
| Description | Rabbit polyclonal WDR13 antibody raised against the N terminal of WDR13 |
| Gene | WDR13 |
| Supplier Page | Shop |