| Name | FAM79B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3505 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM79B antibody was raised using the N terminal Of Fam79B corresponding to a region with amino acids DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGH |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM79B Blocking Peptide |
| Description | Rabbit polyclonal FAM79B antibody raised against the N terminal Of Fam79B |
| Gene | TPRG1 |
| Supplier Page | Shop |