| Name | WARS2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2414 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG |
| Purity/Format | Affinity purified |
| Blocking Peptide | WARS2 Blocking Peptide |
| Description | Rabbit polyclonal WARS2 antibody raised against the middle region of WARS2 |
| Gene | WARS2 |
| Supplier Page | Shop |