Name | WARS2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2414 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG |
Purity/Format | Affinity purified |
Blocking Peptide | WARS2 Blocking Peptide |
Description | Rabbit polyclonal WARS2 antibody raised against the middle region of WARS2 |
Gene | WARS2 |
Supplier Page | Shop |