| Name | VISA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6463 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | VISA antibody was raised using the C terminal of VISA corresponding to a region with amino acids VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | VISA Blocking Peptide |
| Description | Rabbit polyclonal VISA antibody raised against the C terminal of VISA |
| Gene | ISYNA1 |
| Supplier Page | Shop |