| Name | CYP2A13 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1870 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CYP2A13 antibody was raised using the C terminal of CYP2A13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CYP2A13 Blocking Peptide |
| Description | Rabbit polyclonal CYP2A13 antibody raised against the C terminal of CYP2A13 |
| Gene | CYP2A7 |
| Supplier Page | Shop |