Name | CYP2A13 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1870 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CYP2A13 antibody was raised using the C terminal of CYP2A13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | CYP2A13 Blocking Peptide |
Description | Rabbit polyclonal CYP2A13 antibody raised against the C terminal of CYP2A13 |
Gene | CYP2A7 |
Supplier Page | Shop |