| Name | FCRLA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7201 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FCRLA antibody was raised using the C terminal of FCRLA corresponding to a region with amino acids MPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRKPGTTKATAE |
| Purity/Format | Affinity purified |
| Blocking Peptide | FCRLA Blocking Peptide |
| Description | Rabbit polyclonal FCRLA antibody raised against the C terminal of FCRLA |
| Gene | FCRLB |
| Supplier Page | Shop |