| Name | MVK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3344 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MVK antibody was raised using the N terminal of MVK corresponding to a region with amino acids LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAA |
| Purity/Format | Affinity purified |
| Blocking Peptide | MVK Blocking Peptide |
| Description | Rabbit polyclonal MVK antibody raised against the N terminal of MVK |
| Gene | MVK |
| Supplier Page | Shop |