| Name | FBXO25 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1163 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog, Zebrafish |
| Antigen | FBXO25 antibody was raised using the C terminal of FBXO25 corresponding to a region with amino acids AKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | FBXO25 Blocking Peptide |
| Description | Rabbit polyclonal FBXO25 antibody raised against the C terminal of FBXO25 |
| Gene | FBXO25 |
| Supplier Page | Shop |