SLC26A4 antibody

Name SLC26A4 antibody
Supplier Fitzgerald
Catalog 70R-7041
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen SLC26A4 antibody was raised using the middle region of SLC26A4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL
Purity/Format Affinity purified
Blocking Peptide SLC26A4 Blocking Peptide
Description Rabbit polyclonal SLC26A4 antibody raised against the middle region of SLC26A4
Gene PTGDS
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.