| Name | LENG4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1902 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | LENG4 Blocking Peptide |
| Description | Rabbit polyclonal LENG4 antibody raised against the C terminal Of Leng4 |
| Gene | MBOAT7 |
| Supplier Page | Shop |