| Name | GANC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4273 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GANC antibody was raised using the middle region of GANC corresponding to a region with amino acids VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR |
| Purity/Format | Affinity purified |
| Blocking Peptide | GANC Blocking Peptide |
| Description | Rabbit polyclonal GANC antibody raised against the middle region of GANC |
| Gene | GANC |
| Supplier Page | Shop |