| Name | PIP3-E antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3184 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PIP3-E antibody was raised using the middle region of PIP3-E corresponding to a region with amino acids IHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKE |
| Purity/Format | Affinity purified |
| Blocking Peptide | PIP3-E Blocking Peptide |
| Description | Rabbit polyclonal PIP3-E antibody raised against the middle region of PIP3-E |
| Gene | IPCEF1 |
| Supplier Page | Shop |