| Name | SLC25A46 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1747 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Zebrafish |
| Antigen | SLC25A46 antibody was raised using the N terminal of SLC25A46 corresponding to a region with amino acids RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SLC25A46 Blocking Peptide |
| Description | Rabbit polyclonal SLC25A46 antibody raised against the N terminal of SLC25A46 |
| Gene | SLC25A46 |
| Supplier Page | Shop |