Name | EEF1G antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1200 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | EEF1G antibody was raised using the N terminal of EEF1G corresponding to a region with amino acids AAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | EEF1G Blocking Peptide |
Description | Rabbit polyclonal EEF1G antibody raised against the N terminal of EEF1G |
Gene | EEF1G |
Supplier Page | Shop |