C15ORF27 antibody

Name C15ORF27 antibody
Supplier Fitzgerald
Catalog 70R-7078
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen C15ORF27 antibody was raised using the middle region of C15Orf27 corresponding to a region with amino acids PAGSAQTSPELEHRVSLFNQKNQEGFTVFQIRPVIHFQPTVPMLEDKFRS
Purity/Format Affinity purified
Blocking Peptide C15ORF27 Blocking Peptide
Description Rabbit polyclonal C15ORF27 antibody raised against the middle region of C15Orf27
Gene C15orf27
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.