C16ORF71 antibody

Name C16ORF71 antibody
Supplier Fitzgerald
Catalog 70R-3221
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C16ORF71 antibody was raised using the middle region of C16Orf71 corresponding to a region with amino acids KASACARKVPADTPQDTKEADSGSRCASRKQGSQAGPGPQLAQGMRLNAE
Purity/Format Affinity purified
Blocking Peptide C16ORF71 Blocking Peptide
Description Rabbit polyclonal C16ORF71 antibody raised against the middle region of C16Orf71
Gene C16orf71
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.