| Name | LONRF1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1168 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | LONRF1 antibody was raised using the N terminal of LONRF1 corresponding to a region with amino acids MSSPAVARTSPGGSREMAPAPQGRGRFWEVGGGSGHRLERAAAESERWEL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | LONRF1 Blocking Peptide |
| Description | Rabbit polyclonal LONRF1 antibody raised against the N terminal of LONRF1 |
| Gene | LONRF1 |
| Supplier Page | Shop |