Name | PEX3 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1040 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | PEX3 antibody was raised using the N terminal of PEX3 corresponding to a region with amino acids KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | PEX3 Blocking Peptide |
Description | Rabbit polyclonal PEX3 antibody raised against the N terminal of PEX3 |
Gene | PEX3 |
Supplier Page | Shop |