| Name | CCDC128 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3189 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CCDC128 antibody was raised using the N terminal of CCDC128 corresponding to a region with amino acids KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENE |
| Purity/Format | Affinity purified |
| Blocking Peptide | CCDC128 Blocking Peptide |
| Description | Rabbit polyclonal CCDC128 antibody raised against the N terminal of CCDC128 |
| Gene | PPP1R21 |
| Supplier Page | Shop |