Tetraspanin 10 antibody

• Supplier: Fitzgerald
• Catalog: 70R-6916
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Tetraspanin 10 antibody was raised using the N terminal of TSPAN10 corresponding to a region with amino acids SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG
• Purity/Format: Affinity purified
• Blocking Peptide: Tetraspanin 10 Blocking Peptide
• Description: Rabbit polyclonal Tetraspanin 10 antibody raised against the N terminal of TSPAN10
• Gene: TSPAN10