| Name | C2ORF33 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6372 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C2ORF33 antibody was raised using the C terminal Of C2Orf33 corresponding to a region with amino acids VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW |
| Purity/Format | Affinity purified |
| Blocking Peptide | C2ORF33 Blocking Peptide |
| Description | Rabbit polyclonal C2ORF33 antibody raised against the C terminal Of C2Orf33 |
| Gene | MFF |
| Supplier Page | Shop |