Name | DYDC1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4150 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | DYDC1 antibody was raised using the middle region of DYDC1 corresponding to a region with amino acids EDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQD |
Purity/Format | Affinity purified |
Blocking Peptide | DYDC1 Blocking Peptide |
Description | Rabbit polyclonal DYDC1 antibody raised against the middle region of DYDC1 |
Gene | DYDC1 |
Supplier Page | Shop |