| Name | ATP6V0C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6564 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ATP6V0C antibody was raised using the middle region of ATP6V0C corresponding to a region with amino acids VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG |
| Purity/Format | Affinity purified |
| Blocking Peptide | ATP6V0C Blocking Peptide |
| Description | Rabbit polyclonal ATP6V0C antibody raised against the middle region of ATP6V0C |
| Gene | ATP6V0C |
| Supplier Page | Shop |