| Name | USP12 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3798 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | USP12 antibody was raised using the middle region of USP12 corresponding to a region with amino acids ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG |
| Purity/Format | Affinity purified |
| Blocking Peptide | USP12 Blocking Peptide |
| Description | Rabbit polyclonal USP12 antibody raised against the middle region of USP12 |
| Gene | USP12 |
| Supplier Page | Shop |