| Name | PPP2R5D antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4534 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PPP2R5D antibody was raised using the middle region of PPP2R5D corresponding to a region with amino acids ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA |
| Purity/Format | Affinity purified |
| Blocking Peptide | PPP2R5D Blocking Peptide |
| Description | Rabbit polyclonal PPP2R5D antibody raised against the middle region of PPP2R5D |
| Gene | PPP2R5D |
| Supplier Page | Shop |