| Name | C13ORF31 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4182 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C13ORF31 antibody was raised using the middle region of C13Orf31 corresponding to a region with amino acids TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN |
| Purity/Format | Affinity purified |
| Blocking Peptide | C13ORF31 Blocking Peptide |
| Description | Rabbit polyclonal C13ORF31 antibody raised against the middle region of C13Orf31 |
| Gene | LACC1 |
| Supplier Page | Shop |