| Name | CAMKV antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3638 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CAMKV antibody was raised using the N terminal of CAMKV corresponding to a region with amino acids NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF |
| Purity/Format | Affinity purified |
| Blocking Peptide | CAMKV Blocking Peptide |
| Description | Rabbit polyclonal CAMKV antibody raised against the N terminal of CAMKV |
| Gene | CAMKV |
| Supplier Page | Shop |