| Name | TOR3A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5464 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | TOR3A antibody was raised using the middle region of TOR3A corresponding to a region with amino acids FHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGP |
| Purity/Format | Affinity purified |
| Blocking Peptide | TOR3A Blocking Peptide |
| Description | Rabbit polyclonal TOR3A antibody raised against the middle region of TOR3A |
| Gene | TOR3A |
| Supplier Page | Shop |