Name | SPATA7 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4374 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | SPATA7 antibody was raised using the middle region of SPATA7 corresponding to a region with amino acids FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN |
Purity/Format | Affinity purified |
Blocking Peptide | SPATA7 Blocking Peptide |
Description | Rabbit polyclonal SPATA7 antibody raised against the middle region of SPATA7 |
Gene | SPATA7 |
Supplier Page | Shop |