| Name | GPR27 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7334 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids LVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAV |
| Purity/Format | Affinity purified |
| Blocking Peptide | GPR27 Blocking Peptide |
| Description | Rabbit polyclonal GPR27 antibody raised against the middle region of GPR27 |
| Gene | GPR27 |
| Supplier Page | Shop |