| Name | CDYL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2099 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CDYL antibody was raised using the N terminal of CDYL corresponding to a region with amino acids YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV |
| Purity/Format | Affinity purified |
| Blocking Peptide | CDYL Blocking Peptide |
| Description | Rabbit polyclonal CDYL antibody raised against the n terminal of CDYL |
| Gene | CDYL |
| Supplier Page | Shop |