IGFBP2 antibody

Name IGFBP2 antibody
Supplier Fitzgerald
Catalog 70R-5304
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen IGFBP2 antibody was raised using the middle region of IGFBP2 corresponding to a region with amino acids KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ
Purity/Format Affinity purified
Blocking Peptide IGFBP2 Blocking Peptide
Description Rabbit polyclonal IGFBP2 antibody raised against the middle region of IGFBP2
Gene IGFBP2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.