| Name | PCDH17 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2580 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PCDH17 antibody was raised using the C terminal of PCDH17 corresponding to a region with amino acids SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK |
| Purity/Format | Affinity purified |
| Blocking Peptide | PCDH17 Blocking Peptide |
| Description | Rabbit polyclonal PCDH17 antibody raised against the C terminal of PCDH17 |
| Gene | PCDH17 |
| Supplier Page | Shop |