DCK antibody

Name DCK antibody
Supplier Fitzgerald
Catalog 70R-4406
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen DCK antibody was raised using the middle region of DCK corresponding to a region with amino acids ATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQ
Purity/Format Affinity purified
Blocking Peptide DCK Blocking Peptide
Description Rabbit polyclonal DCK antibody raised against the middle region of DCK
Gene DCK
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.