Name | DCK antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4406 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | DCK antibody was raised using the middle region of DCK corresponding to a region with amino acids ATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQ |
Purity/Format | Affinity purified |
Blocking Peptide | DCK Blocking Peptide |
Description | Rabbit polyclonal DCK antibody raised against the middle region of DCK |
Gene | DCK |
Supplier Page | Shop |