| Name | KIAA1754L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6820 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KIAA1754L antibody was raised using the C terminal of KIAA1754L corresponding to a region with amino acids EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKT |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIAA1754L Blocking Peptide |
| Description | Rabbit polyclonal KIAA1754L antibody raised against the C terminal of KIAA1754L |
| Gene | ITPRIPL1 |
| Supplier Page | Shop |