NARG1 antibody

Name NARG1 antibody
Supplier Fitzgerald
Catalog 70R-4598
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen NARG1 antibody was raised using the middle region of NARG1 corresponding to a region with amino acids PPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPNDDGKEEPPTT
Purity/Format Affinity purified
Blocking Peptide NARG1 Blocking Peptide
Description Rabbit polyclonal NARG1 antibody raised against the middle region of NARG1
Gene NAA15
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.