| Name | HNRPL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1329 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | HNRPL Blocking Peptide |
| Description | Rabbit polyclonal HNRPL antibody raised against the N terminal of HNRPL |
| Gene | HNRNPL |
| Supplier Page | Shop |