Name | NSUN3 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2964 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | NSUN3 antibody was raised using the C terminal of NSUN3 corresponding to a region with amino acids LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP |
Purity/Format | Affinity purified |
Blocking Peptide | NSUN3 Blocking Peptide |
Description | Rabbit polyclonal NSUN3 antibody raised against the C terminal of NSUN3 |
Gene | NSUN3 |
Supplier Page | Shop |