NOV antibody

Name NOV antibody
Supplier Fitzgerald
Catalog 70R-1715
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NOV antibody was raised using the C terminal of NOV corresponding to a region with amino acids KTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGK
Purity/Format Total IgG Protein A purified
Blocking Peptide NOV Blocking Peptide
Description Rabbit polyclonal NOV antibody raised against the C terminal of NOV
Gene NOV
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.