SLC26A1 antibody

Name SLC26A1 antibody
Supplier Fitzgerald
Catalog 70R-6308
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen SLC26A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA
Purity/Format Affinity purified
Blocking Peptide SLC26A1 Blocking Peptide
Description Rabbit polyclonal SLC26A1 antibody
Gene SLC26A1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.