| Name | DLD antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2451 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
| Purity/Format | Affinity purified |
| Blocking Peptide | DLD Blocking Peptide |
| Description | Rabbit polyclonal DLD antibody raised against the middle region of DLD |
| Gene | DLD |
| Supplier Page | Shop |