DPP10 antibody

Name DPP10 antibody
Supplier Fitzgerald
Catalog 70R-6500
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen DPP10 antibody was raised using the middle region of DPP10 corresponding to a region with amino acids VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE
Purity/Format Affinity purified
Blocking Peptide DPP10 Blocking Peptide
Description Rabbit polyclonal DPP10 antibody raised against the middle region of DPP10
Gene DPP10
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.