Name | DPP10 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6500 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | DPP10 antibody was raised using the middle region of DPP10 corresponding to a region with amino acids VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE |
Purity/Format | Affinity purified |
Blocking Peptide | DPP10 Blocking Peptide |
Description | Rabbit polyclonal DPP10 antibody raised against the middle region of DPP10 |
Gene | DPP10 |
Supplier Page | Shop |