| Name | LDHB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3734 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LDHB antibody was raised using the C terminal of LDHB corresponding to a region with amino acids MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD |
| Purity/Format | Affinity purified |
| Blocking Peptide | LDHB Blocking Peptide |
| Description | Rabbit polyclonal LDHB antibody raised against the C terminal of LDHB |
| Gene | LDHB |
| Supplier Page | Shop |