Name | SLC45A2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6692 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | SLC45A2 antibody was raised using the C terminal of SLC45A2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC |
Purity/Format | Affinity purified |
Blocking Peptide | SLC45A2 Blocking Peptide |
Description | Rabbit polyclonal SLC45A2 antibody raised against the C terminal of SLC45A2 |
Gene | SLC45A2 |
Supplier Page | Shop |