Name | TFR2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6697 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | TFR2 antibody was raised using the N terminal of TFR2 corresponding to a region with amino acids RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDP |
Purity/Format | Affinity purified |
Blocking Peptide | TFR2 Blocking Peptide |
Description | Rabbit polyclonal TFR2 antibody raised against the N terminal of TFR2 |
Gene | TFR2 |
Supplier Page | Shop |